missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15945195

Invitrogen™ MEK3 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15945195
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15945195 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15945195 Supplier Invitrogen™ Supplier No. PA579626

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, rat kidney tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human ovarian cancer tissue. ICC/IF: CACO-2 cell. Flow: CACO-2 cell.

MAP2K3 (MEK3) is a dual-specificity protein kinase which acts in cellular signal transduction pathways, and is necessary for the expression of glucose transporter. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for MEK3.
TRUSTED_SUSTAINABILITY

Specifications

Antigen MEK3
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene MAP2K3
Gene Accession No. O09110, P46734
Gene Alias AW212142; dual specificity mitogen-activated protein kinase kinase 3; EC 2.7.12.2; MAP kinase kinase 3; Map2k3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; Mek3; mitogen activated protein kinase kinase 3; mitogen-activated protein kinase kinase 3; Mkk3; mMKK3b; Prkmk3; protein kinase, mitogen-activated, kinase 3; SAPK kinase 2; SAPKK2; SAPKK-2; SKK2; Stress-activated protein kinase kinase 2
Gene Symbols MAP2K3
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26397, 303200, 5606
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.