missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MRCL3 Antibody - Azide and BSA Free, Novus Biologicals™

MRCL3 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. p-200061125 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18641681 0.02 mL 0.02mL
18670681 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18641681 Supplier Novus Biologicals Supplier No. NBP2930800.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

MRCL3 Polyclonal antibody specifically detects MRCL3 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen MRCL3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias MLCBMyosin RLC, MRCL3, MRLC3MLC-2B, MYL2B, myosin regulatory light chain 12A, Myosin regulatory light chain 2, nonsarcomeric, myosin regulatory light chain 3, myosin regulatory light chain MRCL3, Myosin regulatory light chain MRLC3, myosin, light chain 12A, regulatory, non-sarcomeric, myosin, light polypeptide, regulatory, non-sarcomeric (20kD), RLC
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 92-171 of human MYL12A (NP_006462.1). KLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cell Biology, Cytoskeleton Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 10627
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.