missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody, R&D Systems™

N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody, R&D Systems™

Product Code. 18614376 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18614376 25 μL 25µL
18170358 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18614376 Supplier Novus Biologicals Supplier No. NBP23797825ul
  • ONLINE EXCLUSIVE PRICE
    457.09€
    391.65€ / 25µL
    Save 65.44€
    14% Off
 Restricted Item
Estimated Shipment: 02-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

N-Deacetylase/N-Sulfotransferase 1/NDST1 Polyclonal specifically detects N-Deacetylase/N-Sulfotransferase 1/NDST1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen N-Deacetylase/N-Sulfotransferase 1/NDST1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P52848
Gene Alias [Heparan sulfate]-glucosamine N-sulfotransferase 1, bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1, EC 2.8.2.8, Glucosaminyl N-deacetylase/N-sulfotransferase 1, heparan sulfate-N-deacetylase/N-sulfotransferase, HSNST 1, HSST1, HSSTN-HSST 1, N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1, NDST-1, N-heparan sulfate sulfotransferase 1, NST1
Gene Symbols NDST1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: YEPVLLAKTRSSESIPHLGADAGLHAALHATVVQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3340
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.