missing translation for 'onlineSavingsMsg'
Learn More

NET1 Antibody (CL3063), Novus Biologicals™

Product Code. 18649605 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18649605 25 μL 25µL
18658915 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18649605 Supplier Novus Biologicals Supplier No. NBP24664825ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

NET1 Monoclonal antibody specifically detects NET1 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen NET1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3063
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P23975
Gene Alias ARHGEF8neuroepithelial cell-transforming gene 1 protein, guanine nucleotide regulatory protein (oncogene), NET1A, neuroepithelial cell transforming 1, neuroepithelial cell transforming gene 1, neuroepithelioma transforming gene 1, p65 Net1 proto-oncogene protein, Proto-oncogene p65 Net1, Rho guanine nucleotide exchange factor (GEF) 8, Rho guanine nucleotide exchange factor 8, small GTP-binding protein regulator
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNGSVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIHDI
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10276
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.