missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Neuroglycan C/CSPG5 Antibody, Novus Biologicals™

Neuroglycan C/CSPG5 Antibody, Novus Biologicals™

Product Code. 18292361 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18292361 100 μL 100µL
18650828 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18292361 Supplier Novus Biologicals Supplier No. NBP256381

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Neuroglycan C/CSPG5 Polyclonal specifically detects Neuroglycan C/CSPG5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigen Neuroglycan C/CSPG5
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CALEB, chondroitin sulfate proteoglycan 5, chondroitin sulfate proteoglycan 5 (neuroglycan C), MGC44034, Neuroglycan C, NGCAcidic leucine-rich EGF-like domain-containing brain protein
Gene Symbols CSPG5
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGVTAKAGSGDAQALPATLQAPHEVLGQSIMPPAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNL
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 10675
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.