missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NLE1 Antibody - Azide and BSA Free, Novus Biologicals™

NLE1 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18665890 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18665890 0.02 mL 0.02mL
18664411 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18665890 Supplier Novus Biologicals Supplier No. NBP2933330.02ml

Please to purchase this item. Need a web account? Register with us today!

This item has been discontinued and is no longer available. View the product for possible alternatives or contact our Technical Support team on 056 260 260 for assistance.
 View alternative products

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

NLE1 Polyclonal antibody specifically detects NLE1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen NLE1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias FLJ10458, Nle, Notchless gene homolog, notchless homolog 1 (Drosophila), notchless protein homolog 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 268-353 of human NLE1 (NP_060566.2). TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Stem Cells
Primary or Secondary Primary
Gene ID (Entrez) 54475
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.