missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
NLE1 Polyclonal antibody specifically detects NLE1 in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | NLE1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | FLJ10458, Nle, Notchless gene homolog, notchless homolog 1 (Drosophila), notchless protein homolog 1 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 268-353 of human NLE1 (NP_060566.2). TIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRYNLVRGQGPERLVSGSDDFTL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?