missing translation for 'onlineSavingsMsg'
Learn More

p70 S6 Kinase beta/S6K2 Antibody, Novus Biologicals™

Product Code. 18204677 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18204677 0.1 mL 0.1mL
18453792 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18204677 Supplier Novus Biologicals Supplier No. NBP187805

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

p70 S6 Kinase beta/S6K2 Polyclonal specifically detects p70 S6 Kinase beta/S6K2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen p70 S6 Kinase beta/S6K2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20-1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.11, EC 2.7.11.1, KLS, p70 ribosomal S6 kinase beta, p70 S6 kinase beta, p70 S6KB, p70 S6K-beta, p70(S6K)-beta, p70-beta, P70-beta-1, P70-beta-2, p70-S6K 2, P70S6K2, p70S6Kb, ribosomal protein S6 kinase beta-2, ribosomal protein S6 kinase, 70kD, polypeptide 2,70 kDa ribosomal protein S6 kinase 2, ribosomal protein S6 kinase, 70kDa, polypeptide 2, S6K2, S6K-beta, S6K-beta2, S6K-beta-2, serine/threonine-protein kinase 14 beta, Serine/threonine-protein kinase 14B, SRK, STK14BS6 kinase-related kinase
Gene Symbols RPS6KB2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRAPVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6199
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.