missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody, Novus Biologicals™

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Antibody, Novus Biologicals™

Product Code. 18668736 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18668736 25 μL 25µL
18667847 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18668736 Supplier Novus Biologicals Supplier No. NBP26863325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 Polyclonal antibody specifically detects Protein O-Glucosyltransferase 1/POGLUT1/KTELC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Protein O-Glucosyltransferase 1/POGLUT1/KTELC1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias 9630046K23Rik, C3orf9, CAP10-like protein, 46 kDa, chromosome 3 open reading frame 9, CLP46, EC 2.4.1.-, hCLP46CAP10-like 46 kDa protein, KDELC family like 1, KDELCL1, KTEL (Lys-Tyr-Glu-Leu) containing 1, KTEL motif-containing protein 1, MDS010, MDSRPKTELC1, MGC32995, Myelodysplastic syndromes relative protein, protein O-glucosyltransferase 1, Rumi, x 010 protein
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFIL
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Developmental Biology
Primary or Secondary Primary
Gene ID (Entrez) 56983
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.