missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-58001
This item is not returnable.
View return policy
Description
PSG1 Polyclonal specifically detects PSG1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| PSG1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| B1G1CD66 antigen-like family member F, CD66f, CD66f antigen, DHFRP2, Fetal liver non-specific cross-reactive antigen 1/2, FLJ90598, FLJ90654, FL-NCA-1/2, PBG1, pregnancy specific beta-1-glycoprotein 1, pregnancy-specific B-1 glycoprotein, Pregnancy-specific beta-1 glycoprotein C/D, pregnancy-specific beta-1-glycoprotein 1, Pregnancy-specific glycoprotein 1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1SP1, PSGGAPSG95, PSGIIA | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 5669 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Q6ICR4 | |
| PSG1 | |
| Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the N terminal of PSG1. Peptide sequence SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%. | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction