missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PSG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
484.00€
Specifications
| Antigen | PSG1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
PSG1 Polyclonal specifically detects PSG1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| PSG1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q6ICR4 | |
| 5669 | |
| Synthetic peptides corresponding to PSG1(pregnancy specific beta-1-glycoprotein 1) The peptide sequence was selected from the N terminal of PSG1. Peptide sequence SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| B1G1CD66 antigen-like family member F, CD66f, CD66f antigen, DHFRP2, Fetal liver non-specific cross-reactive antigen 1/2, FLJ90598, FLJ90654, FL-NCA-1/2, PBG1, pregnancy specific beta-1-glycoprotein 1, pregnancy-specific B-1 glycoprotein, Pregnancy-specific beta-1 glycoprotein C/D, pregnancy-specific beta-1-glycoprotein 1, Pregnancy-specific glycoprotein 1, PS-beta-C/D, PS-beta-G-1, PSBG-1, PSBG1SP1, PSGGAPSG95, PSGIIA | |
| PSG1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title