missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SCN7A Polyclonal antibody specifically detects SCN7A in Human, Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | SCN7A |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | Sodium channel protein cardiac and skeletal muscle subunit alpha, Sodium channel protein type VII subunit alpha, sodium channel, voltage-gated, type VI, alpha, sodium channel, voltage-gated, type VII, alpha, sodium channel, voltage-gated, type VII, alpha polypeptide, voltage-dependent sodium channel alpha subunit, voltage-gated, type VI, alpha polypeptide |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 265-368 of human SCN7A (NP_002967.2). HKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYHQILYASGK |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?