missing translation for 'onlineSavingsMsg'
Learn More

SCN7A Antibody - BSA Free, Novus Biologicals™

Product Code. 18607110 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.01mL
0.02mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18607110 0.1 mL 0.01mL
18617741 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18607110 Supplier Novus Biologicals Supplier No. NBP2945840.1ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SCN7A Polyclonal antibody specifically detects SCN7A in Human, Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SCN7A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias Sodium channel protein cardiac and skeletal muscle subunit alpha, Sodium channel protein type VII subunit alpha, sodium channel, voltage-gated, type VI, alpha, sodium channel, voltage-gated, type VII, alpha, sodium channel, voltage-gated, type VII, alpha polypeptide, voltage-dependent sodium channel alpha subunit, voltage-gated, type VI, alpha polypeptide
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 265-368 of human SCN7A (NP_002967.2). HKCFRWPQENENETLHNRTGNPYYIRETENFYYLEGERYALLCGNRTDAGQCPEGYVCVKAGINPDQGFTNFDSFGWALFALFRLMAQDYPEVLYHQILYASGK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6332
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.