missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TC-PTP/PTPN2 Antibody, R&D Systems™

TC-PTP/PTPN2 Antibody, R&D Systems™

Produktkod. 18603116 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Quantity:
25 μL
0.1 mL
Förpackningsstorlek:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Quantity Förpackningsstorlek
18603116 25 μL 25µL
18645706 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18603116 Leverantör Novus Biologicals Leverantörsnummer NBP24884125ul
 Restricted Item
Estimated Shipment: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

TC-PTP/PTPN2 Polyclonal specifically detects TC-PTP/PTPN2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen TC-PTP/PTPN2
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias protein tyrosine phosphatase, non-receptor type 2, PTPTPTN2, T-cell protein tyrosine phosphatase, T-cell protein-tyrosine phosphatase, TCELLPTP, TC-PTP, TCPTPEC 3.1.3.48, tyrosine-protein phosphatase non-receptor type 2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQP
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5771
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.