missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM79 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59832
This item is not returnable.
View return policy
Description
TMEM79 Polyclonal specifically detects TMEM79 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
Specifications
| TMEM79 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| FLJ16057, FLJ32254, MGC13102, transmembrane protein 79 | |
| Rabbit | |
| 43 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence | |
| Q9BSE2 | |
| TMEM79 | |
| Synthetic peptide directed towards the C terminal of human TMEM79 (NP_115699). Peptide sequence LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG. | |
| Affinity purified | |
| RUO | |
| 84283 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction