missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TMEM79 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
512.00€
Specifications
| Antigen | TMEM79 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TMEM79 Polyclonal specifically detects TMEM79 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.Specifications
| TMEM79 | |
| Polyclonal | |
| Rabbit | |
| Q9BSE2 | |
| 84283 | |
| Synthetic peptide directed towards the C terminal of human TMEM79 (NP_115699). Peptide sequence LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| FLJ16057, FLJ32254, MGC13102, transmembrane protein 79 | |
| TMEM79 | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title