missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZNF177 Antibody - Azide and BSA Free, Novus Biologicals™

ZNF177 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18673221 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18673221 0.02 mL 0.02mL
18699210 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18673221 Supplier Novus Biologicals Supplier No. NBP2938710.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ZNF177 Polyclonal antibody specifically detects ZNF177 in Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZNF177
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias PIGX, zinc finger protein 177
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2). LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7730
Target Species Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.