accessibility menu, dialog, popup

UserName
New Feature

You can now browse the site in English or Français.

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (6,310)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

centrifuge

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (138)

brands

  • (1)
  • (8)
  • (6,299)
  • (1)
  • (1)

special programs

  • (6)

Applications

  • (3)
  • (9)
  • (10)
  • (2)
  • (32)
  • (51)
  • (1)
Show all

Classification

  • (785)
  • (5,522)
  • (2)

Conjugate

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Host Species

  • (2)
  • (17)
  • (3)
  • (2)
  • (755)
  • (5,525)
  • (5)

Quantity

  • (9)
  • (9)
  • (5)
  • (1)
  • (5)
  • (103)
  • (28)
Show all

Target Species

  • (1)
  • (5)
  • (1)
  • (1)
  • (4,232)
  • (4,175)
  • (5)
Show all

Regulatory Status

  • (6,307)

Isotype

  • (5,491)
  • (25)
  • (497)
  • (4)
  • (2)
  • (2)
  • (128)
Show all

Form

  • (50)
  • (9)
  • (14)
  • (1,430)
1 – 15 of 6,296 results
1

Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)
GREENER_CHOICE

Mouse Monoclonal Antibody

2

Invitrogen™ La Crosse Virus Monoclonal Antibody (8C2.2)
GREENER_CHOICE

Mouse Monoclonal Antibody

3

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

4

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

5

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

6

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

10

ZNF879 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Antigen ZNF879
Gene Symbols ZNF879
Regulatory Status RUO
Molecular Weight of Antigen 77 kDa
Gene Alias zinc finger protein 879
Gene ID (Entrez) 345462
Immunogen Synthetic peptide directed towards the N terminal of human DKFZp686E2433. Peptide sequence: MKSGGTNAGGSARETRRLSGAQAQLRPAATGNVSELGVPLASCAVWSCAP
Classification Polyclonal
Primary or Secondary Primary
11

ZNF680 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_848653
Antigen ZNF680
Gene Symbols ZNF680
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias FLJ90430, zinc finger protein 680
Gene ID (Entrez) 340252
Immunogen Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY
Classification Polyclonal
Primary or Secondary Primary
12

ZNF548 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_690873
Antigen ZNF548
Gene Symbols ZNF548
Regulatory Status RUO
Molecular Weight of Antigen 63 kDa
Gene Alias FLJ32932, zinc finger protein 548
Gene ID (Entrez) 147694
Immunogen Synthetic peptide directed towards the N terminal of human ZNF548. Peptide sequence VHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQN.
Classification Polyclonal
Primary or Secondary Primary
13

ZNF778 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. NP_872337
Antigen ZNF778
Gene Symbols ZNF778
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 49 kDa
Gene Alias FLJ31875, MGC150573, zinc finger protein 778
Gene ID (Entrez) 197320
Immunogen Synthetic peptide directed towards the middle region of human FLJ31875. Peptide sequence AFTGLSGLSKHVQTDPGQKPYECKDCGKACGGFYLLNEHGKTHTREKPFA.
Classification Polyclonal
Primary or Secondary Primary
14

ZNF491 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689569
Antigen ZNF491
Gene Symbols ZNF491
Regulatory Status RUO
Molecular Weight of Antigen 51 kDa
Gene Alias FLJ34791, MGC126639, zinc finger protein 491
Gene ID (Entrez) 126069
Immunogen Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE
Classification Polyclonal
Primary or Secondary Primary
15

SSX5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_783729
Antigen SSX5
Gene Symbols SSX5
Regulatory Status RUO
Molecular Weight of Antigen 22 kDa
Gene Alias MGC9494, protein SSX5, synovial sarcoma, X breakpoint 5
Gene ID (Entrez) 6758
Immunogen The immunogen for this antibody is SSX5 - C-terminal region. Peptide sequence EGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRV.
Classification Polyclonal
Primary or Secondary Primary